Scaffold Ga0103958_1172549

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103958_1172549

Scaffold Ga0103958_1172549

Overview

Basic Information
Taxon OID	3300007212 Open in IMG/M
Scaffold ID	Ga0103958_1172549 Open in IMG/M
Source Dataset Name	Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	The Singapore Centre on Environmental Life Sciences Engineering
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1056
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Punggol Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.409238	Long. (^o)	103.907928	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065463	Metagenome / Metatranscriptome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103958_11725492	F065463	N/A	MAACSNCKKTLSCGCQKKKASDGASVCNSCYTSYEASLKQRRAILKESQPNQVWGKERYNKS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.