Scaffold Ga0103274_1201411

Overview

Basic Information

• Taxon OID: 3300007202
• Scaffold ID: Ga0103274_1201411
• Source Dataset Name: Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projects
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: National University of Singapore, Singapore-MIT Alliance for Research and Technology, The Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1393
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freashwater Reservoir, Singapore (Monthly Sampling)

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.286816
  • Long. (^o): 103.867024

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012967	Metagenome / Metatranscriptome	275	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103274_12014114	F012967	AGGA	MMTTTMTNEYRRSVLAPKPRVSFDPRNKNHMLDFARFVKYNNWKDGCSYFLEDPYSDIPTMIRAKIAEAVVASFAEKV*