Scaffold Ga0103273_1136231

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103273_1136231

Scaffold Ga0103273_1136231

Overview

Basic Information
Taxon OID	3300007200 Open in IMG/M
Scaffold ID	Ga0103273_1136231 Open in IMG/M
Source Dataset Name	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site B) 9 sequencing projects
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	The Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1672
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freashwater Reservoir, Singapore (Monthly Sampling)

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.286816	Long. (^o)	103.77518	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085216	Metagenome / Metatranscriptome	111	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103273_11362311	F085216	GGAGG	VTHRFVKFGFAGIVASLSLGSLLTGCGGGGVDQNYLDSSSRALVGTYSKTSISALGTRVTCGDASSVVGDPKTELKDRNVVIDVCTPTDTITFSEDGRYTIKSYGGTESGTFTRDRQRLELVRDTENGRELSTPYQKTVYTLSGSGSEFVFTPTAEPVGYQKIDPAGAAFNVDNTPNYDNLAPKANTDGTLAILWLPNADSKPVLKSDLSIVPELIADAKEAIDARGFSKRYVVTYTFGKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.