Scaffold Ga0102978_1130616

Overview

Basic Information

• Taxon OID: 3300007177
• Scaffold ID: Ga0102978_1130616
• Source Dataset Name: Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: The Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1004
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freshwater Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.286816
  • Long. (^o): 103.867024

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020535	Metagenome / Metatranscriptome	223	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0102978_11306162	F020535	AGGAG	MAAGTPFTGKSMTFKTGASPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITFDADSGDPVAIDYAFDGQGLPAKSGTAFDIIA*