Scaffold Ga0102977_1087681

Overview

Basic Information

• Taxon OID: 3300007171
• Scaffold ID: Ga0102977_1087681
• Source Dataset Name: Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: The Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3940
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freshwater Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.286816
  • Long. (^o): 103.867024

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010085	Metagenome / Metatranscriptome	308	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102977_10876813	F010085	GGAG	LRKIQTVSKYIALSEEGLVPRLECPMDQGLLMPNIDTNDNIYLYCLSCAYKNIMGTEVYDNLLGIVNEAEK*