Scaffold Ga0079302_1026668

Overview

Basic Information

• Taxon OID: 3300007165
• Scaffold ID: Ga0079302_1026668
• Source Dataset Name: Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1427
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa

Source Dataset Sampling Location

• Location Name: USA: Ohio
• Coordinates
  • Lat. (^o): 40.178
  • Long. (^o): -81.073

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021760	Metagenome / Metatranscriptome	217	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079302_10266684	F021760	N/A	SFLRNPIMSGRIDYTFQDFINDAEPEEWAEWEQKAAELEVTVDYYVQEFI*