NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101663_1038219

Scaffold Ga0101663_1038219


Overview

Basic Information
Taxon OID3300007134 Open in IMG/M
Scaffold IDGa0101663_1038219 Open in IMG/M
Source Dataset NameMarine sponge C. singaporensis microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', co6ic19
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of New South Wales
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)851
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → C. Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location NameUpa-Upasina 'control' site, Papua New Guinea
CoordinatesLat. (o)-9.828217Long. (o)150.820517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073669Metagenome120N

Sequences

Protein IDFamilyRBSSequence
Ga0101663_10382192F073669N/AMIEPNMKLLEAMRTEANLCYERGDDEDGNALVKSIFDQIFPGLVEEAKRNPTIIYTLIIHSNTEKDEMKANHYRSILKYLKDNGVKF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.