Scaffold Ga0102532_1122299

Overview

Basic Information

• Taxon OID: 3300007094
• Scaffold ID: Ga0102532_1122299
• Source Dataset Name: Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: The Singapore Centre on Environmental Life Sciences Engineering
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2149
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin217 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Singapore - A Non-Axenic Oscillatoriales Culture (M13A)

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.3991438
  • Long. (^o): 103.77518

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092027	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102532_11222994	F092027	N/A	MKIKRIIKVEVPKEIWDADMSIWNVLFMRKDIMGAWMKSIVEVVKQKY*