Scaffold Ga0101646_1008828

Overview

Basic Information

• Taxon OID: 3300007069
• Scaffold ID: Ga0101646_1008828
• Source Dataset Name: Marine sponge Cinachyra sp. microbiome, Papua New Guinea CO2seep, Dobu 'bubble', cg4ads
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 1034
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Cinachyra Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Dobu 'bubble' site, Papua New Guinea
• Coordinates
  • Lat. (^o): -9.73665
  • Long. (^o): 150.867667

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073669	Metagenome	120	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0101646_10088284	F073669	GGA	MIEPNMKLLEAMRDEANLCYERGDEADGNALVESIFAQIFPGLVEAAKNDPKIIYQLIIQANSSDVRLADHSKSILLYLKNEGVKF*