Scaffold Ga0101535_1024910

Overview

Basic Information

• Taxon OID: 3300007053
• Scaffold ID: Ga0101535_1024910
• Source Dataset Name: Marine sponge C. singaporensis associated microbial community from CO2 seep in Upa-Upasina, Papua New Guinea - co35is
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 620
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Upa-Upasina 'bubble' site, Papua New Guinea
• Coordinates
  • Lat. (^o): -9.8241
  • Long. (^o): 150.825833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000999	Metagenome	809	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101535_10249103	F000999	AGG	MNLEDLTKEVERIEAKSDFVVSWWAKKYKKTIRRIGNLNKEGCRVWEQGGKKYMCFWDVVIERYTTCIDPVITYKKGLN*