Scaffold Ga0102536_120468

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0102536_120468

Scaffold Ga0102536_120468

Overview

Basic Information
Taxon OID	3300007043 Open in IMG/M
Scaffold ID	Ga0102536_120468 Open in IMG/M
Source Dataset Name	Human stool microbial communities from NIH, USA - visit 1, subject 638754422
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	500
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location Name	USA: Maryland: Natonal Institute of Health
Coordinates	Lat. (^o)	39.0042816	Long. (^o)	-77.1012173	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044554	Metagenome	154	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0102536_1204682	F044554	N/A	ALCASIARLFPCRTEIARCLTLDFAISRYLFLSFSFSFRTIFAQALFSSLLFVSDTRAKSILFLLFENEIAHLQGQYRFDSHRYCFSAFLVL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.