Scaffold Ga0080110_105834

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0080110_105834

Scaffold Ga0080110_105834

Overview

Basic Information
Taxon OID	3300006966 Open in IMG/M
Scaffold ID	Ga0080110_105834 Open in IMG/M
Source Dataset Name	Non-marine hypersaline water viral communities from Mallorca, Spain, 2014 - E1 T11
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Alicante
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	683
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Mallorca 2014 (Spain)E1

Source Dataset Sampling Location
Location Name	Salinas de Campos (Mallorca)
Coordinates	Lat. (^o)	39.338015	Long. (^o)	3.051796	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096726	Metagenome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0080110_1058342	F096726	AGGAGG	MTRDEWIDPADTEASIREHVERLARGDRLDVDTPTGTERIERRGPEWRLTHLGTGGGWCWAERMDTRQLVDYLTQWRSREGFDPITVRFVEDGGE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.