Basic Information | |
---|---|
Taxon OID | 3300006937 Open in IMG/M |
Scaffold ID | Ga0081243_1136180 Open in IMG/M |
Source Dataset Name | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A01 (Metagenome Metatranscriptome) (version 2) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 709 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil → Tropical Rainforest Soil Microbial Communities From The Amazon Forest, Brazil, For Analyzing Deforestation At Different Spatial Scales |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Amazon Forest, Brazil | |||||||
Coordinates | Lat. (o) | -10.0 | Long. (o) | -62.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030100 | Metagenome / Metatranscriptome | 186 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0081243_11361801 | F030100 | N/A | NVSRIIPGDWGKVESGWLAQLLRERIERFEGRGRIHQFLWQRSRAVSKREKGTEGRGTIRNRSEFSQVARGSFEFERIAVTRG* |
⦗Top⦘ |