Basic Information | |
---|---|
Taxon OID | 3300006918 Open in IMG/M |
Scaffold ID | Ga0079216_10968465 Open in IMG/M |
Source Dataset Name | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 652 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: North Logan, Utah | |||||||
Coordinates | Lat. (o) | 41.7655 | Long. (o) | -111.8143 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F020900 | Metagenome / Metatranscriptome | 221 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0079216_109684651 | F020900 | N/A | VAPDHLDLVHRIRALLDASAEGAGLPRNEVEPTLTEGYARALELEAACLRLEHRIDGLTRAIADGREIPQGKLSGLLRRLHDTEQQAEDLRALLAPLRELVAKA |
⦗Top⦘ |