Scaffold Ga0070750_10489844

Overview

Basic Information

• Taxon OID: 3300006916
• Scaffold ID: Ga0070750_10489844
• Source Dataset Name: Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 505
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → unclassified Acinetobacter → Acinetobacter sp. HA (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location

• Location Name: USA: Delaware Bay
• Coordinates
  • Lat. (^o): 39.12
  • Long. (^o): -75.25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078756	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0070750_104898441	F078756	AGGAG	VSDTIGNLVDRVFREYLEPMDSVESYSYLTGGITTTTQSTINYEEGMFSTEEEDALGAGAIIEVNQELMFSKGLNAVTNEITVERGARGTTAALHSAGDIIKIAPAFTRKAVFDAVSDQIKNLYPTLFAVETIELTASTGYKLLGTYGT