Scaffold Ga0075436_100578680

Overview

Basic Information

• Taxon OID: 3300006914
• Scaffold ID: Ga0075436_100578680
• Source Dataset Name: Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 826
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location

• Location Name: USA: Tennessee
• Coordinates
  • Lat. (^o): 35.8444
  • Long. (^o): -83.9599
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033539	Metagenome / Metatranscriptome	177	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0075436_1005786802	F033539	AGGGGG	MKKLVVMMAAVSAIAAIIGASDASAQSWGRRGANVRCLNGGVVQGRWYCNLKHAPPGEWNNYRSTGRYKLRAGM