Scaffold Ga0073928_10026246

Overview

Basic Information

• Taxon OID: 3300006893
• Scaffold ID: Ga0073928_10026246
• Source Dataset Name: Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5755
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (63.64%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Canada: Banff
• Coordinates
  • Lat. (^o): 51.1699
  • Long. (^o): -116.1578

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053582	Metagenome / Metatranscriptome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073928_1002624610	F053582	AGG	MKKSELLKALREEIQRHNLDTFMSAEHKIVQTGCSICQKHFGTVEQFKRHITEDVLPPLLNRLSGEVKSGEAGEA*