Scaffold Ga0102492_104650

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0102492_104650

Scaffold Ga0102492_104650

Overview

Basic Information
Taxon OID	3300006888 Open in IMG/M
Scaffold ID	Ga0102492_104650 Open in IMG/M
Source Dataset Name	Combined Assembly of Gp0125122, Gp0125123, Gp0125658
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Shell Corporation
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2295
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Source Dataset Sampling Location
Location Name	UK (Newcastle upon Tyne)
Coordinates	Lat. (^o)	54.971158	Long. (^o)	-1.703654	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020363	Metagenome / Metatranscriptome	224	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102492_1046502	F020363	N/A	MWRWRRVAVARVFALVVRCRDMILFVYSRVGKNRDTRRESPAGAGAGRTADHLTVLFSQKFLAVRKANDIYRPVMLRFLTCLYCSKL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.