 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300006864 Open in IMG/M |
| Scaffold ID | Ga0066797_1047287 Open in IMG/M |
| Source Dataset Name | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1514 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alaska, USA | |||||||
| Coordinates | Lat. (o) | 68.6135 | Long. (o) | -149.3144 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011415 | Metagenome / Metatranscriptome | 291 | N |
| F013549 | Metagenome / Metatranscriptome | 270 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066797_10472871 | F013549 | GGAG | MRLWRPVWFPLAAFAVVALLPTAAYAEAPGNDGGTVNVGPVSNGPVVSQGTAGYDPSGISATTATHPSGSGTTSSVPTYTYHPVPNNAIPAPGPIQNNNGVLSNPNAPLSQPACPAGQTGYYVYDSNGNSLGMVCVPNPTDSLLPPTTPEIALADQASSRQPWPTLVMGINPGTGLTGLPSWFWLRGSASMPDATASSGPLTVSVRARLAGVTWEFGDGIGYDSIDLGQAYPAQSDVQHVYQTDTYGLSNGYTAAAVLRY |
| Ga0066797_10472872 | F011415 | AGAAGG | MLTRSARSRGFGGSVGDAILGSWTRTVAVVAVALVIFGIIGFLAATGRLGDLHYANIPLVHPYPPAGFSQNSFNPTDRGDLINTATAAKVKSDLVADGQIELRAYQTSDGSLLAGADTGNRLAKLRSALDQNHAAGVFEDFTNQLTTVRVGKLVDPNDSSVTWCIEEIGTSRITLTRAADGSVLSQYSIRFDDKFWLRSVAGRYLITDAEVQSETTSS* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |