Scaffold Ga0066797_1014246

Overview

Basic Information

• Taxon OID: 3300006864
• Scaffold ID: Ga0066797_1014246
• Source Dataset Name: Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2742
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location

• Location Name: Alaska, USA
• Coordinates
  • Lat. (^o): 68.6135
  • Long. (^o): -149.3144

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019971	Metagenome / Metatranscriptome	226	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066797_10142461	F019971	N/A	VQSSKITADVRAFFTSYCTAFIRQDAQAIAKHFADMVHVATDTGGDVSVHVANAVEWRKTIDRILEMYRAIDVGSVEATGLATDALSSRLVQARLRWALSDRAARPLYEFDAMYTLARHTDTFRITALAHNEIPEYRRCLARFDRVEKKPPLSSY*