Scaffold Ga0079299_1004491

Overview

Basic Information

• Taxon OID: 3300006862
• Scaffold ID: Ga0079299_1004491
• Source Dataset Name: Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3395
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa

Source Dataset Sampling Location

• Location Name: USA: Ohio
• Coordinates
  • Lat. (^o): 40.178
  • Long. (^o): -81.073

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024101	Metagenome	207	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079299_10044911	F024101	AGG	MSKEKPIHKMIDEVFDKELETELFDEIVEERNFIVNTLKTWIETDAIWEQMVNNKEERKQFLMHMQMLFLTELENSTLIELATTKHGDK*