Scaffold Ga0075433_10017815

Overview

Basic Information

• Taxon OID: 3300006852
• Scaffold ID: Ga0075433_10017815
• Source Dataset Name: Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5892
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location

• Location Name: USA: Tennessee
• Coordinates
  • Lat. (^o): 35.8444
  • Long. (^o): -83.9599
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060084	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075433_100178151	F060084	N/A	RADPVGAYRDWFRAQEELRERGEASVARALADDLWAMLSELPFSAAEERARFLHNAAVFYGSPGPGADLARARVLFATALEHFATDPESGWHARALHNFATSLSNLGADAAALEESESLFQRALEWRTSEREIARGVTLHNLGLARRRLAELDPERAAQHLAASAAVLAEAVEIRERHGLFEGRALSERHLALTRELLDRARGGSGATRGTDTLGE*