Basic Information | |
---|---|
Taxon OID | 3300006840 Open in IMG/M |
Scaffold ID | Ga0101790_148959 Open in IMG/M |
Source Dataset Name | Anaerobic bioreactor microbial communities from Canach, Luxembourg |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Centre de Recherche Public Gabriel Lippmann |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1145 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Anaerobic Reactor → Anaerobic Bioreactor Microbial Communities From Different Locations In Luxembourg |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canach, Luxembourg | |||||||
Coordinates | Lat. (o) | 49.609581 | Long. (o) | 6.325797 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F055749 | Metagenome / Metatranscriptome | 138 | N |
F103315 | Metagenome / Metatranscriptome | 101 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0101790_1489592 | F103315 | GGGGG | MITVEIYIFLAAVVAAAFVYIFLDLDNRLYGNLFAAGFAGILSGLLALWSFNENTVTITTVPQTAIAVQHYLNDTLANVTTTYAYQTHIVPIVDPALGYFWMLVMVFMWFLVGYFVLEIMHESRMPDDEEAYE* |
Ga0101790_1489594 | F055749 | N/A | MNLIIAIAIGILTLIAVFSVIPVVGGSIDNAMPPLAEDSDWNTTTNPDLPSGASMWSQLGPLLVLAVLALVIGLVIMYFRNAAG |
⦗Top⦘ |