Scaffold Ga0101790_123276

Overview

Basic Information

• Taxon OID: 3300006840
• Scaffold ID: Ga0101790_123276
• Source Dataset Name: Anaerobic bioreactor microbial communities from Canach, Luxembourg
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Centre de Recherche Public Gabriel Lippmann
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1179
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → unclassified Alcaligenaceae → Alcaligenaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Anaerobic Reactor → Anaerobic Bioreactor Microbial Communities From Different Locations In Luxembourg

Source Dataset Sampling Location

• Location Name: Canach, Luxembourg
• Coordinates
  • Lat. (^o): 49.609581
  • Long. (^o): 6.325797

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095115	Metagenome / Metatranscriptome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101790_1232764	F095115	AGGAGG	MIRTMQQALKYAMAKSEDPVKIKEYMEEYFAAIGGDRRYKFKWRALSGNHKYTFSGIFEYQGKAYYFHKTGDNLVLEYHN*