Scaffold Ga0079220_10425036

Overview

Basic Information

• Taxon OID: 3300006806
• Scaffold ID: Ga0079220_10425036
• Source Dataset Name: Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 878
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 33.8834
  • Long. (^o): -83.4195

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013437	Metagenome	271	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079220_104250362	F013437	N/A	MPSTALTWIEPGASATLIWHGAAATGPGGARLYAVSGPALEQPPATPYFLLAPAEVDAFAARLYRGQVSLDDLRAFLAHCRIAQGALVDEMQYLAVADEAPVLPVLDAWREAADVPALPYLDDINAFMPAGPLYVTAEAHAVARREPEQFATAWVCDECGEASDAGVVFWT