Scaffold Ga0098042_1069754

Overview

Basic Information

• Taxon OID: 3300006749
• Scaffold ID: Ga0098042_1069754
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 923
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -14.198
  • Long. (^o): -77.499
  • Depth (m): 38

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089018	Metagenome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0098042_10697542	F089018	AGGA	MIYDSRIEEWLDRCPEHDNEILHSDADGIVVVIRFNNQKEEDEEKN*