Scaffold Ga0098037_1013356

Overview

Basic Information

• Taxon OID: 3300006737
• Scaffold ID: Ga0098037_1013356
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3147
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -12.999
  • Long. (^o): -80.801
  • Depth (m): 90

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090511	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0098037_10133565	F090511	N/A	MGLNHVAYHGNKDCNQDWLNGYFQAKKDLEMQLGQIIITHDDLDCNA*