NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0098033_1001125

Scaffold Ga0098033_1001125


Overview

Basic Information
Taxon OID3300006736 Open in IMG/M
Scaffold IDGa0098033_1001125 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11265
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (26.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-13.003Long. (o)-80.809Alt. (m)Depth (m)275
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033590Metagenome / Metatranscriptome177Y
F033600Metagenome / Metatranscriptome177Y
F072246Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0098033_100112510F033600N/AMMKGLLFEDLYKYTNKYWKDVKSRHVRPTTKTLADIAKASPETYNQVKAELVPFPGDHLIEQLGSAFKSISDATGLITQLFENPSIHLDEKIVKSATLKLQKIQDLIKSVSEDLDHDETDS*
Ga0098033_100112511F033590N/AMGKFENKFLSLLKEDEFGAATPDVAPAVDAEPGDDQQSFANALDEPEHAKDFEDVIDQNPNEQQELSDLQEWIGNIDEVLQYLNGGISSVLGKLRNDNKVGTIFADVSDATKSEILDVCERLASLNQIFKNLYIEKHK*
Ga0098033_10011258F072246N/AMKNNSSADREIKQYSQLARWLCLYEAVNIISDKAEKMGHKGDCLKPIPINKYINERYHSVLKDVEYEFSNNLHTRHH*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.