Scaffold Ga0031682_1093375

Overview

Basic Information

• Taxon OID: 3300006695
• Scaffold ID: Ga0031682_1093375
• Source Dataset Name: Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP324 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 578
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: East of Recife, Brazil, South Atlantic Ocean
• Coordinates
  • Lat. (^o): -9.13
  • Long. (^o): -30.19

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051950	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0031682_10933751	F051950	N/A	TTRSDVLVHLAQ*QY***F*FAFL*SFYYFLTARVVRYGSLKMKPKMSTSFRPHGK*GDFIAAIIPAI*CVNILSNSNFILRLIE*QNESSLFTIRVRARQ*Y*VYKFELKNFTDILSAPKNIGYNK*SVNTFGDLQVAEDYLYVLQLRSQNK*VKNY*EEVLQKTEEVKKNHIVAPQEQLRLEILNKSNLN