Scaffold Ga0031679_1103198

Overview

Basic Information

• Taxon OID: 3300006691
• Scaffold ID: Ga0031679_1103198
• Source Dataset Name: Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP138 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 563
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: West of Cape Verde, Atlantic Ocean
• Coordinates
  • Lat. (^o): 14.52
  • Long. (^o): -26.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068737	Metatranscriptome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0031679_11031981	F068737	N/A	GGMCFMMFMSGAEEKLSCIERTACEDPYLATDYLTAAKMIYKGYKLVGMHIADKYATVMNSVNDALEYGKSGAECSAKYHW*