Scaffold Ga0101729_1029283

Overview

Basic Information

• Taxon OID: 3300006652
• Scaffold ID: Ga0101729_1029283
• Source Dataset Name: Combined Assembly of Gp0123698, Gp0123960, Gp0123961
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Shell Corporation
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 770
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Source Dataset Sampling Location

• Location Name: UK (Newcastle upon Tyne)
• Coordinates
  • Lat. (^o): 54.971158
  • Long. (^o): -1.703654

Associated Families

Family	Category	Number of Sequences	3D Structure?
F106197	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101729_10292831	F106197	N/A	NNVWNSGNCKIHSEVLGMKRVLLCIPLLLLCISVDSVSADTISAQIDSFDFPSGDWYCGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPESVYAEPGDSTYFVIPVWNIPDDAELGEYQADFYLYGYYDSRTGELSEQLDQVDQVRAFSVVG*