NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075522_10028169

Scaffold Ga0075522_10028169


Overview

Basic Information
Taxon OID3300006638 Open in IMG/M
Scaffold IDGa0075522_10028169 Open in IMG/M
Source Dataset NameArctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3441
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameUSA: Barrow Environmental Observatory site, Alaska
CoordinatesLat. (o)71.299Long. (o)-156.61Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008383Metagenome / Metatranscriptome334Y

Sequences

Protein IDFamilyRBSSequence
Ga0075522_100281694F008383AGGAGMARAKAALKPAPTNLASLIRGLYGRVAKQLKVDPSYVSRVARGERQSEEIEMSLEKELRRIMSMVRMNHNGAKRHSPKRAQVALKKKKKLA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.