Basic Information | |
---|---|
Taxon OID | 3300006618 Open in IMG/M |
Scaffold ID | Ga0101566_10738793 Open in IMG/M |
Source Dataset Name | Soil microbial communities from the Leymus chinensis steppe, China - without N addition |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chengdu Institute of Biology, Chinese Academy of Sciences |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 599 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The Leymus Chinensis Steppe, China - Nitrogen Deposition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | the Inner Mongolia Grassland Ecosystem Research Station (IMGERS), China | |||||||
Coordinates | Lat. (o) | 43.63 | Long. (o) | 116.7 | Alt. (m) | Depth (m) | .1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F062955 | Metagenome / Metatranscriptome | 130 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0101566_107387931 | F062955 | N/A | LEELEQTLERRERDLVSYVDQLQGAMSGVSDDAWWSRPAGGDGGVLS* |
⦗Top⦘ |