Basic Information | |
---|---|
Taxon OID | 3300006616 Open in IMG/M |
Scaffold ID | Ga0101440_124424 Open in IMG/M |
Source Dataset Name | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ06 time point |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Australian Centre for Ecogenomics |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2224 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water → Exploring Phylogenetic Diversity In Port Hacking Ocean In Sydney, Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Port Hacking, Australia | |||||||
Coordinates | Lat. (o) | -34.1192 | Long. (o) | 151.2267 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041305 | Metagenome / Metatranscriptome | 160 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0101440_1244242 | F041305 | AGG | MSIKAKVRTTGKLKGKAQSQQEIVATTVEIQSGDLRLGDLADINAAGXNGAVLVYDGVNGEFKVTTQVENENLNITGGTY* |
⦗Top⦘ |