Scaffold Ga0074049_12927686

Overview

Basic Information

• Taxon OID: 3300006580
• Scaffold ID: Ga0074049_12927686
• Source Dataset Name: Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 520
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Rhizosphere Microbial Communities From Centre Inrs-Institut Armand-Frappier, Laval, Canada

Source Dataset Sampling Location

• Location Name: Laval, Canada
• Coordinates
  • Lat. (^o): 45.54
  • Long. (^o): -73.72

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067718	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074049_129276862	F067718	AGG	MDELHICQPPMEQRPASASGEWQCPDCGTWWAIEAGVPSQVTPAYDFLAHQGVVPARWVLRESD*