Scaffold Ga0101390_1005214

Overview

Basic Information

• Taxon OID: 3300006562
• Scaffold ID: Ga0101390_1005214
• Source Dataset Name: Marine microbial communities from the Black Sea in Odessa region - Od_2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Hellenic Centre for Marine Research (HCMR)
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 598
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Investigation Of Black Sea Water Bacterial Metagenome

Source Dataset Sampling Location

• Location Name: Illichivsk, Odessa region, Ukraine
• Coordinates
  • Lat. (^o): 46.302094
  • Long. (^o): 30.668915
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026012	Metagenome / Metatranscriptome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101390_10052142	F026012	N/A	VRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK*