Scaffold Ga0101389_1000071

Overview

Basic Information

• Taxon OID: 3300006561
• Scaffold ID: Ga0101389_1000071
• Source Dataset Name: Marine microbial communities from the Black Sea in Odessa region - Od_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Hellenic Centre for Marine Research (HCMR)
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 2123
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Investigation Of Black Sea Water Bacterial Metagenome

Source Dataset Sampling Location

• Location Name: Vapnyarka, Odessa Oblast, Ukraine
• Coordinates
  • Lat. (^o): 46.35116
  • Long. (^o): 30.5519
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066141	Metagenome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101389_10000715	F066141	AGGA	MSRKNKIELFMMLDRVNQSLDTKLDLNNAPHYGGWQLKNEEGNTIIKHRVPIKEMSSFLDGMSKALEMKG*