Basic Information | |
---|---|
Taxon OID | 3300006467 Open in IMG/M |
Scaffold ID | Ga0099972_13280155 Open in IMG/M |
Source Dataset Name | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | JGI facility at Oak Ridge National Laboratory, Brown University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2491 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (16.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Marine → Coastal Sediment Microbial Communities From Rhode Island, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rhode Island | |||||||
Coordinates | Lat. (o) | 40.435 | Long. (o) | -70.483 | Alt. (m) | Depth (m) | 78 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F071259 | Metagenome | 122 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0099972_132801555 | F071259 | GGAG | MKRKQSRIIIGTAISAAVIAVAIDHTRQRLPQAEKQLASQDAVIIIDEGEELPAENGDDCGKPAGRGRQASPCSL* |
⦗Top⦘ |