Scaffold Ga0099972_10018359

Overview

Basic Information

• Taxon OID: 3300006467
• Scaffold ID: Ga0099972_10018359
• Source Dataset Name: Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: JGI facility at Oak Ridge National Laboratory, Brown University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1134
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Marine → Coastal Sediment Microbial Communities From Rhode Island, Usa

Source Dataset Sampling Location

• Location Name: Rhode Island
• Coordinates
  • Lat. (^o): 40.435
  • Long. (^o): -70.483
  • Depth (m): 78

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010473	Metagenome / Metatranscriptome	303	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099972_100183594	F010473	N/A	LGIKDLGFITLYTKAFTMELLRYEIKAGFFKGVLFGIRHYPFEDEQIYEEDIVIYFGIFQLVITRIYRK*