Scaffold Ga0082249_10000246

Overview

Basic Information

• Taxon OID: 3300006466
• Scaffold ID: Ga0082249_10000246
• Source Dataset Name: Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten VI
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Center for Biotechnology (CeBiTec), Bielefeld Univeristy
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6033
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities

Source Dataset Sampling Location

• Location Name: Fram Strait
• Coordinates
  • Lat. (^o): 77.978277
  • Long. (^o): 0.163645
  • Depth (m): 3500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082716	Metagenome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082249_100002469	F082716	GGAG	MINKKDLRQMPFTFIIAPILLVALTSVVAITYGEMIEEKELIVTLSCPDLKEYTENQFIESKLYFGHDVYLNYAKELYRDFC*