Scaffold Ga0075037_1959684

Overview

Basic Information

• Taxon OID: 3300006426
• Scaffold ID: Ga0075037_1959684
• Source Dataset Name: Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 561
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location

• Location Name: Alaska, USA
• Coordinates
  • Lat. (^o): 68.6137
  • Long. (^o): -149.3144
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003050	Metagenome / Metatranscriptome	510	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075037_19596841	F003050	AGGA	MESAKAEAVVGEGKAVTSERSSFGMISCGAPESVEAVTAKTVAGEQTGKAHGAPKRDAQYGCMPVVS