Scaffold Ga0082247_10024974

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0082247_10024974

Scaffold Ga0082247_10024974

Overview

Basic Information
Taxon OID	3300006421 Open in IMG/M
Scaffold ID	Ga0082247_10024974 Open in IMG/M
Source Dataset Name	Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten I
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Center for Biotechnology (CeBiTec), Bielefeld Univeristy
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	893
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities

Source Dataset Sampling Location
Location Name	Fram Strait
Coordinates	Lat. (^o)	78.153207	Long. (^o)	5.975413	Alt. (m)		Depth (m)	1200
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073762	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082247_100249742	F073762	AGGA	MPKIKLSKLVKKINKENEPPEGWTPEAKEGFKHAAALGIALHDLDDGGDMAEELNQIMELDSDLYK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.