NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0069787_12556048

Scaffold Ga0069787_12556048


Overview

Basic Information
Taxon OID3300006417 Open in IMG/M
Scaffold IDGa0069787_12556048 Open in IMG/M
Source Dataset NameCombined Assembly of Gp0110018, Gp0110022, Gp0110020
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAustralian Centre for Ecogenomics, Aalborg University, University of Queensland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)661
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia

Source Dataset Sampling Location
Location NameThorneside, Queensland, Australia
CoordinatesLat. (o)-27.485973Long. (o)153.190699Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045770Metagenome / Metatranscriptome152Y

Sequences

Protein IDFamilyRBSSequence
Ga0069787_125560481F045770N/AMADLTKDAPLRIWGEIVSQKWLLDTSAAQTIYKGQPMIIDQSADTVNLCGFVDATVVAATDIFVGIAYEAAAVAIGAAETTEIEVLVEPTIVGFAGSVFTNADVGDTVYMSDSGTLSATAADNPMIGKLVRVKDGFQYVRLSSPTICAGA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.