Scaffold Ga0069787_10601259

Overview

Basic Information

• Taxon OID: 3300006417
• Scaffold ID: Ga0069787_10601259
• Source Dataset Name: Combined Assembly of Gp0110018, Gp0110022, Gp0110020
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Australian Centre for Ecogenomics, Aalborg University, University of Queensland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1406
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia

Source Dataset Sampling Location

• Location Name: Thorneside, Queensland, Australia
• Coordinates
  • Lat. (^o): -27.485973
  • Long. (^o): 153.190699

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093898	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0069787_106012591	F093898	GGTGG	MMRFLIARAVNPQLTLLDGLRDWNNIAAALREPPRKRRQYQGDNLGEFLS*