Scaffold Ga0069787_10173399

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0069787_10173399

Scaffold Ga0069787_10173399

Overview

Basic Information
Taxon OID	3300006417 Open in IMG/M
Scaffold ID	Ga0069787_10173399 Open in IMG/M
Source Dataset Name	Combined Assembly of Gp0110018, Gp0110022, Gp0110020
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Australian Centre for Ecogenomics, Aalborg University, University of Queensland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2971
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia

Source Dataset Sampling Location
Location Name	Thorneside, Queensland, Australia
Coordinates	Lat. (^o)	-27.485973	Long. (^o)	153.190699	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002371	Metagenome / Metatranscriptome	566	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0069787_101733991	F002371	N/A	ETRGGTRKNAGAKPKYNEQTKTVAFRCPMSKVDELKLIVKSKLSEWSLK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.