Basic Information | |
---|---|
Taxon OID | 3300006417 Open in IMG/M |
Scaffold ID | Ga0069787_10117000 Open in IMG/M |
Source Dataset Name | Combined Assembly of Gp0110018, Gp0110022, Gp0110020 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Australian Centre for Ecogenomics, Aalborg University, University of Queensland |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 16895 |
Total Scaffold Genes | 20 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Thorneside, Queensland, Australia | |||||||
Coordinates | Lat. (o) | -27.485973 | Long. (o) | 153.190699 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F080249 | Metagenome / Metatranscriptome | 115 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0069787_1011700016 | F080249 | N/A | MADDKTKVGRQDDNLISFKQKYEVDYAVNQLKKAFPDESRKDVKEALFKAARENSPSEGREKIMRAARKNLRG* |
⦗Top⦘ |