Basic Information | |
---|---|
Taxon OID | 3300006415 Open in IMG/M |
Scaffold ID | Ga0099654_10300057 Open in IMG/M |
Source Dataset Name | Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake community |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Institut Pasteur, Lille, France |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 583 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Algae And Fungi Communities From Freshwater Lake In Auvergne, France During And After Algae Bloom |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Auvergne, France | |||||||
Coordinates | Lat. (o) | 45.49 | Long. (o) | 2.88 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025035 | Metagenome / Metatranscriptome | 203 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0099654_103000571 | F025035 | N/A | IRLYAAKAQAAGGKPVCDGDTIYIKVMSGRYIGEIDGTTKKEWVKARGTKKDKDHALKIEKKGGGEVESGDIVMFVMPNGVHMDVMGSAVRARYYDPRGEWQKIMIIKQEGGIIRDGDTIFLKGMFKNGRDYLDANPLEKFPDGEVKCRWPDEGDWQVMTIEK* |
⦗Top⦘ |