NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075503_1674284

Scaffold Ga0075503_1674284


Overview

Basic Information
Taxon OID3300006400 Open in IMG/M
Scaffold IDGa0075503_1674284 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2244
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (91.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034945Metagenome / Metatranscriptome173Y
F042350Metagenome / Metatranscriptome158Y
F076122Metagenome / Metatranscriptome118Y
F090460Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0075503_16742841F076122N/AHEVVNKILDYLDTRRTELSNEMASVAYQSTDYDALDAMYEVYDHLIAKLEDDFR*
Ga0075503_167428410F034945GGAMGDRANVGIRGSDRNTIFLYLHWGGADRNETVANALAHAMARDGDEAYFTRIFISRVIDRDWDKETGVGLSVNKLSAQGDGYSVPIYDYTTKKVEIHEELWDVAGGFTNHTDIEYPRDMYLAEYAVRGVGSYV*
Ga0075503_16742844F042350AGGAMAGRESEYMRGYLRGVAAMMNLITSDKVKRLDKRNVLEYARGLVEAQKEETNVPQR*
Ga0075503_16742847F090460AGGAGMVNDKFSDKEYWEGIQYACEYFRDELGFEDATETTLYQQATEELALV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.