NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079069_1361832

Scaffold Ga0079069_1361832


Overview

Basic Information
Taxon OID3300006387 Open in IMG/M
Scaffold IDGa0079069_1361832 Open in IMG/M
Source Dataset NameActive sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Oil_02_SludgeMetaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)700
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameIllinois, USA
CoordinatesLat. (o)40.1191Long. (o)-88.1952Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048390Metagenome / Metatranscriptome148Y

Sequences

Protein IDFamilyRBSSequence
Ga0079069_13618321F048390N/ARTLQHRVTPHGRDFYALSIPPQVAEALNLKAGGSVDIIVSPVKKSMFEVTLKPTPVELSQSLKEV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.