Scaffold Ga0079079_1042593

Overview

Basic Information

• Taxon OID: 3300006360
• Scaffold ID: Ga0079079_1042593
• Source Dataset Name: Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Val_03_SludgeMetaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2627
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Illinois, USA
• Coordinates
  • Lat. (^o): 40.1191
  • Long. (^o): -88.1952

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049074	Metagenome / Metatranscriptome	147	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0079079_10425934	F049074	GGAGG	MDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE*